PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00269.1_g00021.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 370aa    MW: 42963.2 Da    PI: 6.5282
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00269.1_g00021.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.34.2e-55101391129
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyW 83 
                              +ppGfrFhPtdeelv +yL+kkv+++k++l +vi+++d+y++ePwdL++  ++   e++ewyfFs++dkky+tg+r+nrat  g+W
  Rsa1.0_00269.1_g00021.1  10 VPPGFRFHPTDEELVGYYLRKKVASQKIDL-DVIRDIDLYRIEPWDLQErcRIGYeERNEWYFFSHKDKKYPTGTRTNRATMVGFW 94 
                              69****************************.9***************953433332556*************************** PP

                      NAM  84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                              katg+dk+v++ k++l+g++ktLvfykgrap+g+ktdW+mheyrle
  Rsa1.0_00269.1_g00021.1  95 KATGRDKAVYD-KSKLMGMRKTLVFYKGRAPNGQKTDWIMHEYRLE 139
                              ***********.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.27E-607159IPR003441NAC domain
PROSITE profilePS5100559.11710159IPR003441NAC domain
PfamPF023651.1E-2811138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MESVDQSCSV PPGFRFHPTD EELVGYYLRK KVASQKIDLD VIRDIDLYRI EPWDLQERCR  60
IGYEERNEWY FFSHKDKKYP TGTRTNRATM VGFWKATGRD KAVYDKSKLM GMRKTLVFYK  120
GRAPNGQKTD WIMHEYRLES DENAPPQEEG WVVCRAFKKK PTTGQAKNTE TWRSGYFYDQ  180
LPSGTGSGME PLNYVPKRKQ NIFSQDFMFK QELEGSNIGL NFIHCDQFIQ LPQLESPSLP  240
LMQRPVSSTS ITSLEKNHNK FKRPLTEDDE KFNELICSKR KDKKKKSSVM TTDWRALDKF  300
VASQLMSQED GFSDFGVHQE DDNNKTGQRN NEESSNNGID MPTSSLLSDG EEENRFISGL  360
LCTNLDYDLI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-5141609169Stress-induced transcription factor NAC1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1278285KRKDKKKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1895690.0AC189569.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH009I12, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013595944.10.0PREDICTED: NAC domain-containing protein 76-like
RefseqXP_013595945.10.0PREDICTED: NAC domain-containing protein 76-like
SwissprotO655080.0NAC76_ARATH; NAC domain-containing protein 76
TrEMBLA0A0D3DHY40.0A0A0D3DHY4_BRAOL; Uncharacterized protein
STRINGBra017750.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36862661
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36160.10.0NAC domain containing protein 76